PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02366.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 252aa    MW: 27445.4 Da    PI: 9.2824
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02366.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM453.4e-1453796128
        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                +++lvg+kktLvfykgrapkgek++Wvmheyr+
  PK02366.3   5 STNLVGMKKTLVFYKGRAPKGEKSNWVMHEYRI 37 
                5678***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.99158IPR003441NAC domain
SuperFamilySSF1019411.44E-18558IPR003441NAC domain
PfamPF023651.7E-6937IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
XSSSSTNLVG MKKTLVFYKG RAPKGEKSNW VMHEYRINSK SAFRTSKDEW VVCRVFQKSA  60
GAKKYPTTST QTRTMNPYAL IDQTQTMLQY SSPMMQLPGD PTGHFLFARN NCNNITNNPH  120
ELAELSRVLR GTTSGSTNPL NVLPSQYNYP VPILPGGGGG GGGGGGCLTI SGLNLNLGGA  180
PPPQAPPHQA QMMNLNQHNI MSSNSGSFGH HDHNNGYGSE MNNVPNNGAA NNNRSYMNVD  240
HCMDLENYWP AY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-14364108171NO APICAL MERISTEM PROTEIN
1ut4_B1e-14364108171NO APICAL MERISTEM PROTEIN
1ut7_A1e-14364108171NO APICAL MERISTEM PROTEIN
1ut7_B1e-14364108171NO APICAL MERISTEM PROTEIN
3swm_A2e-14364111174NAC domain-containing protein 19
3swm_B2e-14364111174NAC domain-containing protein 19
3swm_C2e-14364111174NAC domain-containing protein 19
3swm_D2e-14364111174NAC domain-containing protein 19
3swp_A2e-14364111174NAC domain-containing protein 19
3swp_B2e-14364111174NAC domain-containing protein 19
3swp_C2e-14364111174NAC domain-containing protein 19
3swp_D2e-14364111174NAC domain-containing protein 19
4dul_A1e-14364108171NAC domain-containing protein 19
4dul_B1e-14364108171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523724.34e-68PREDICTED: protein CUP-SHAPED COTYLEDON 2 isoform X2
TrEMBLK7KIT45e-68K7KIT4_SOYBN; Uncharacterized protein
TrEMBLK7KIT25e-68K7KIT2_SOYBN; Uncharacterized protein
STRINGGLYMA04G08320.28e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.25e-36NAC domain containing protein 38